VAMP3 Protein, Human (His)

VAMP3 protein is an important SNARE protein that promotes vesicle transport from late endosomes to the trans-Golgi network. Its interaction with BVES, mediated by its C-terminal cytoplasmic tail, is crucial in this process. VAMP3 Protein, Human (His) is the recombinant human-derived VAMP3 protein, expressed by E. coli , with N-His labeled tag. The total length of VAMP3 Protein, Human (His) is 77 a.a., with molecular weight of ~11 kDa.

VAMP3, a critical SNARE protein, plays a key role in orchestrating vesicular transport from late endosomes to the trans-Golgi network. The interaction with BVES, facilitated through its C-terminus cytoplasmic tail, assumes significance in this transport process. Moreover, VAMP3 collaborates with BCAP31, contributing to the efficient export of VAMP3 from the endoplasmic reticulum. Notably, the association with BAIAP3 is subject to modulation by calcium, revealing a nuanced regulatory aspect. In addition to these interactions, VAMP3 engages with PICALM, further underscoring the intricate network of molecular associations governing its diverse cellular functions.

Human

E. coli

N-10*His

Q15836 (M1-K77)

9341  [NCBI]

MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCK

Approximately 12 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.