1. Recombinant Proteins
  2. Others
  3. TREM-2 Protein, Cynomolgus (HEK293, His)

TREM-2 Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P72438
COA Handling Instructions

TREM-2 protein forms a signaling complex with TYROBP, activates cells upon ligand binding, and acts as a receptor for amyloid beta, lipoproteins, and apolipoproteins. It promotes their uptake by microglia, triggering activation, proliferation, migration, apoptosis and cytokine expression. TREM-2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TREM-2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TREM-2 Protein, Cynomolgus (HEK293, His) is 156 a.a., with molecular weight of 28-40 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $70 In-stock
50 μg $200 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TREM-2 protein forms a signaling complex with TYROBP, activates cells upon ligand binding, and acts as a receptor for amyloid beta, lipoproteins, and apolipoproteins. It promotes their uptake by microglia, triggering activation, proliferation, migration, apoptosis and cytokine expression. TREM-2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TREM-2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TREM-2 Protein, Cynomolgus (HEK293, His) is 156 a.a., with molecular weight of 28-40 kDa.

Background

TREM-2 Protein forms a receptor signaling complex with TYROBP, mediating signaling and cell activation upon ligand binding. It acts as a receptor for amyloid-beta protein 42, facilitating its uptake and degradation by microglia, resulting in microglial activation, proliferation, migration, apoptosis, and cytokine expression. Additionally, TREM-2 serves as a receptor for lipoprotein particles and apolipoproteins, enhancing their uptake in microglia. It binds phospholipids and regulates microglial proliferation, phagocytosis of apoptotic neurons, and response to oxidative stress. Furthermore, TREM-2 suppresses PI3K and NF-kappa-B signaling, promotes anti-apoptotic NF-kappa-B signaling during oxidative stress, and plays a role in microglial MTOR activation and metabolism. It is involved in age-related changes in microglial numbers and triggers immune responses in macrophages and dendritic cells. TREM-2 also mediates cytokine-induced multinucleated giant cell formation and is implicated in osteoclast differentiation. The protein interacts with TYROBP, and this interaction is crucial for stabilizing the TREM-2 C-terminal fragment.

Species

Cynomolgus

Source

HEK293

Tag

C-6*His

Accession

XP_005553122.1 (H19-S174)

Gene ID

102133279  [NCBI]

Molecular Construction
N-term
TREM-2 (H19-S174)
Accession # XP_005553122.1
6*His
C-term
Synonyms
Ig-like domain-containing protein; TREM2; Triggering receptor expressed on myeloid cells 2
AA Sequence

HNTTVFQGVEGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRRNGSTAITDDTLGGTLTITLRNLQPHDAGFYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWVPGESESFEDAHVEHSISRSLLEGEIPFPPTS

Molecular Weight

28-40 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TREM-2 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TREM-2 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P72438
Quantity:
MCE Japan Authorized Agent: