1. Recombinant Proteins
  2. Others
  3. Sap130 Protein, Mouse (His)

Sap130 Protein, Mouse (His)

Cat. No.: HY-P71592
COA Handling Instructions

Sap130 Protein, a transcriptional repressor, participates in mSin3A corepressor complex assembly or enzymatic activity. It's a component of the complex, including SIN3A, SAP130, SUDS3/SAP45, ARID4B/SAP180, HDAC1, and HDAC2. Sap130 also interacts with CLEC4E, especially when released by dead or dying cells. Sap130 Protein, Mouse (His) is the recombinant mouse-derived Sap130 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $86 In-stock
10 μg $138 In-stock
20 μg $220 In-stock
50 μg $420 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Sap130 Protein, a transcriptional repressor, participates in mSin3A corepressor complex assembly or enzymatic activity. It's a component of the complex, including SIN3A, SAP130, SUDS3/SAP45, ARID4B/SAP180, HDAC1, and HDAC2. Sap130 also interacts with CLEC4E, especially when released by dead or dying cells. Sap130 Protein, Mouse (His) is the recombinant mouse-derived Sap130 protein, expressed by E. coli , with N-6*His labeled tag.

Background

Sap130 Protein serves as a transcriptional repressor and may play a role in the assembly and/or enzymatic activity of the mSin3A corepressor complex, or mediate interactions between the complex and other regulatory complexes. It is a component of the mSin3A corepressor complex, comprising SIN3A, SAP130, SUDS3/SAP45, ARID4B/SAP180, HDAC1, and HDAC2. Moreover, Sap130 interacts with CLEC4E, particularly when released by dead or dying cells.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

Q8BIH0-1 (P845-V1057)

Gene ID

269003  [NCBI]

Molecular Construction
N-term
6*His
Sap130 (P845-V1057)
Accession # Q8BIH0-1
C-term
Synonyms
Sap130; Histone deacetylase complex subunit SAP130; 130kDa Sin3-associated polypeptide; Sin3-associated polypeptide p130
AA Sequence

PRKQQHVISTEEGDMMETNSTDDEKSAAKSLLVKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYSDVRVKEEKKAMLQEIANQKGVSCRAQGWKVHLCAAQLLQLTNLEHDVYERLTNLQEGIIPKKKAATDDDLHRINELIQGNMQRCKLVMDQISEARDSMLKVLDHKDRVLKLLNKNGTVKKVSKLKRKEKV

Molecular Weight

Approximately 34 kDa.The reducing (R) protein migrat es as 34 kDa in SDS-PAGE may be due to molecular structure of protein.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trchalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Sap130 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Sap130 Protein, Mouse (His)
Cat. No.:
HY-P71592
Quantity:
MCE Japan Authorized Agent: