RLN1/Relaxin-1 Protein, Human (HEK293, His)

The RLN1/Relaxin-1 protein is an important ovarian hormone that cooperates with estrogen to induce birth canal dilation. It plays a vital role in connective tissue remodeling during pregnancy, promoting pubic ligament growth and cervical ripening. RLN1/Relaxin-1 Protein, Human (HEK293, His) is the recombinant human-derived RLN1/Relaxin-1 protein, expressed by HEK293 , with C-His labeled tag. The total length of RLN1/Relaxin-1 Protein, Human (HEK293, His) is 163 a.a., with molecular weight of ~20 kDa.

RLN1, also known as Relaxin-1, is a vital ovarian hormone that collaborates with estrogen, particularly in numerous mammals, to induce the dilation of the birth canal. This hormone plays a crucial role in the remodeling of connective tissues during pregnancy, facilitating the growth of pubic ligaments and the ripening of the cervix. The functional form of RLN1 exists as a heterodimer, comprised of a B chain and an A chain, intricately linked by two disulfide bonds. Through its intricate molecular structure, RLN1 contributes significantly to the intricate processes associated with pregnancy, influencing the adaptive changes in the female reproductive system to support a successful birth.

Measured by its ability to induce cAMP accumulation in THP‑1 human acute monocytic leukemia cells. The ED₅₀ for this effect is 10.95 ng/mL, corresponding to a specific activity is 9.132×10⁴ U/mg.

Human

HEK293

C-6*His

P04808 (V23-C185)

6013  [NCBI]

VAAKWKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALKDSNLSFEEFKKLIRNRQSEAADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRSLAKYC

Approximately 20 kDa

Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.