1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PCSK6 Protein, Human (His)

PCSK6 Protein, Human (His)

Cat. No.: HY-P700617
Handling Instructions

The PCSK6 protein is a serine endoprotease that plays a key role in preprotein processing by cleavage at sites with paired basic amino acids, specifically recognizing the RXXX[KR]R consensus motif. Its function may be involved in the constitutive secretory pathway, with a unique and limited distribution in neuroendocrine and non-neuroendocrine tissues. PCSK6 Protein, Human (His) is the recombinant human-derived PCSK6 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PCSK6 protein is a serine endoprotease that plays a key role in preprotein processing by cleavage at sites with paired basic amino acids, specifically recognizing the RXXX[KR]R consensus motif. Its function may be involved in the constitutive secretory pathway, with a unique and limited distribution in neuroendocrine and non-neuroendocrine tissues. PCSK6 Protein, Human (His) is the recombinant human-derived PCSK6 protein, expressed by E. coli , with C-6*His labeled tag.

Background

PCSK6 protein, a serine endoprotease, plays a pivotal role in the processing of diverse proproteins by cleaving at sites characterized by paired basic amino acids, specifically recognizing the RXXX[KR]R consensus motif. Its functional involvement is likely associated with the constitutive secretory pathway, exhibiting a distinctive and limited distribution within both neuroendocrine and non-neuroendocrine tissues. The enzyme's ability to precisely cleave substrates at specific motifs highlights its significance in the regulated processing of proproteins in various cellular contexts.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P29122-1 (R860-G969)

Gene ID
Molecular Construction
N-term
PCSK6 (R860-G969)
Accession # P29122-1
6*His
C-term
Synonyms
proprotein convertase subtilisin/kexin type 6; PACE4, paired basic amino acid cleaving system 4; SPC4; subtilisin like proprotein convertase 4; subtilisin like protease; subtilisin/kexin like protease PACE4;
AA Sequence

REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG

Molecular Weight

19.4 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PCSK6 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PCSK6 Protein, Human (His)
Cat. No.:
HY-P700617
Quantity:
MCE Japan Authorized Agent: