1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. OSM Protein, Mouse

OSM Protein, Mouse

Cat. No.: HY-P7275
COA Handling Instructions

OSM Protein, Mouse is a gp130 cytokine family member, shows homeostatic and proinflammatory activities and can modify extracellular matrix.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $115 In-stock
50 μg $320 In-stock
100 μg $600 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

OSM Protein, Mouse is a gp130 cytokine family member, shows homeostatic and proinflammatory activities and can modify extracellular matrix.

Background

Oncostatin M is a gp130 cytokine family member, shows homeostatic and proinflammatory activities and can modify extracellular matrix[1].

Biological Activity

The ED50 is <10 ng/mL as measured by Rat Embryo Brain cells, corresponding to a specific activity of >1.0 × 105 units/mg.

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P53347 (N25-R205)

Gene ID

18413  [NCBI]

Molecular Construction
N-term
OSM (N25-R205)
Accession # P53347
C-term
Synonyms
rMuOSM; Oncostatin-M
AA Sequence

MNRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRVLYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTRSR

Molecular Weight

Approximately 20.5 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

OSM Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
OSM Protein, Mouse
Cat. No.:
HY-P7275
Quantity:
MCE Japan Authorized Agent: