1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. NANS Protein, Human (His)

NANS Protein, Human (His)

Cat. No.: HY-P70959
COA Handling Instructions

NANS Protein is an enzyme that functions in the biosynthetic pathways of sialic acids. NANS protein uses N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), respectively. NANS Protein, Human (His) is the recombinant human-derived NANS protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $100 In-stock
50 μg $280 Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NANS Protein is an enzyme that functions in the biosynthetic pathways of sialic acids. NANS protein uses N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), respectively. NANS Protein, Human (His) is the recombinant human-derived NANS protein, expressed by E. coli , with N-6*His labeled tag.

Background

NANS protein (sialic acid synthases) is an enzyme that functions in the biosynthetic pathways of sialic acids. Both subfamilies of sialic acid synthases possess N-terminal triosephosphate isomerase barrel domain and C-terminal antifreeze protein domain. Sialic acid synthases uses N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), respectively. However, it exhibits much higher activity toward the Neu5Ac phosphate product. NANS catalyzes the condensation of phosphoenolpyruvate (PEP) with either ManNAc (bacteria) or ManNAc-6P (mammals) to give NeuNAc or NeuNAc-9P, respectively. NANS is related to the E. coli sialic acid synthase gene neuB, and it can partially restore sialic acid synthase activity in an E. coli neuB-negative mutant. NANS-mediated sialic acid synthesis has a pivotal role in skeletal development, specifically in growth plate cartilage. NANS mutations impair enzyme activity and lead to accumulation of N-acetylmannosamine in vivo[1][2][3][4].

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

AAH19315.1 (M1-S359)

Gene ID
Molecular Construction
N-term
6*His
NANS (M1-S359)
Accession # AAH19315.1
C-term
Synonyms
Sialic Acid Synthase; N-Acetylneuraminate Synthase; N-Acetylneuraminate-9-Phosphate Synthase; N-Acetylneuraminic Acid Phosphate Synthase; N-Acetylneuraminic Acid Synthase; NANS; SAS
AA Sequence

MPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQLLPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS

Molecular Weight

Approximately 42.0 kDa

Purity

Greater than 84% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

NANS Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NANS Protein, Human (His)
Cat. No.:
HY-P70959
Quantity:
MCE Japan Authorized Agent: