1. Recombinant Proteins
  2. Others
  3. MPZL3 Protein, Human (HEK293, His)

MPZL3 Protein, Human (HEK293, His)

Cat. No.: HY-P73804
COA Handling Instructions

The MPZL3 protein is an important mediator of homogeneous cell-to-cell adhesion and promotes important interactions between cells. Its role in establishing connections emphasizes its importance in cellular cohesion, maintaining structural integrity, and facilitating communication between adjacent cells. MPZL3 Protein, Human (HEK293, His) is the recombinant human-derived MPZL3 protein, expressed by HEK293 , with C-His labeled tag. The total length of MPZL3 Protein, Human (HEK293, His) is 127 a.a., with molecular weight of ~15-19 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
5 μg $66 In-stock
10 μg $105 In-stock
50 μg $275 In-stock
100 μg $440 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MPZL3 protein is an important mediator of homogeneous cell-to-cell adhesion and promotes important interactions between cells. Its role in establishing connections emphasizes its importance in cellular cohesion, maintaining structural integrity, and facilitating communication between adjacent cells. MPZL3 Protein, Human (HEK293, His) is the recombinant human-derived MPZL3 protein, expressed by HEK293 , with C-His labeled tag. The total length of MPZL3 Protein, Human (HEK293, His) is 127 a.a., with molecular weight of ~15-19 kDa.

Background

MPZL3 Protein serves as a crucial mediator of homophilic cell-cell adhesion, facilitating essential interactions between cells. In its role, MPZL3 contributes to the establishment of connections that are integral to cellular cohesion. The protein's function underscores its significance in the processes involving adhesion, emphasizing its role in maintaining the structural integrity and communication between neighboring cells. The homophilic nature of MPZL3-mediated cell adhesion highlights its specificity in fostering interactions between identical molecules, elucidating its pivotal role in various biological contexts where cellular adhesion is fundamental.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q6UWV2-1 (L32-S158)

Gene ID
Molecular Construction
N-term
MPZL3 (L32-S158)
Accession # Q6UWV2
His
C-term
Synonyms
Myelin protein zero-like protein 3; MPZL3
AA Sequence

LEIRADAHVRGYVGEKIKLKCTFKSTSDVTDKLTIDWTYRPPSSSHTVSIFHYQSFQYPTTAGTFRDRISWVGNVYKGDASISISNPTIKDNGTFSCAVKNPPDVHHNIPMTELTVTERGFGTMLSS

Molecular Weight

Approximately 15-19 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MPZL3 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MPZL3 Protein, Human (HEK293, His)
Cat. No.:
HY-P73804
Quantity:
MCE Japan Authorized Agent: