1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-17 Receptor
  5. IL-17RB
  6. IL-17RB Protein, Rhesus Macaque (HEK293, His)

IL-17RB Protein, Rhesus Macaque (HEK293, His)

Cat. No.: HY-P77404
COA Handling Instructions

IL-17RB (Interleukin 17 receptor B), a protein encoded by the IL17RB gene, is a receptor for the pro-inflammatory cytokines IL17B and IL17E. IL-17RB expression is high in kidney, pancreas, liver, brain, and intestines. IL-17RB may play a role in hematopoietic cell differentiation and growth. IL-17RB is involved in inflammatory diseases and cancers. IL-17RB Protein, Rhesus Macaque (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $70 In-stock
50 μg $190 In-stock
100 μg $325 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-17RB (Interleukin 17 receptor B), a protein encoded by the IL17RB gene, is a receptor for the pro-inflammatory cytokines IL17B and IL17E. IL-17RB expression is high in kidney, pancreas, liver, brain, and intestines. IL-17RB may play a role in hematopoietic cell differentiation and growth. IL-17RB is involved in inflammatory diseases and cancers[1][2]. IL-17RB Protein, Rhesus Macaque (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag.

Background

IL-17RB (Interleukin 17 receptor B), a 47.9 kDa transmembrane protein (462 aa) that belongs to the IL-17 receptor family, and can be activated by IL-17B. It has been proved to be involved in inflammatory diseases and cancers. IL-17RB is expressed in various endocrine tissues and in epithelial cells in different organs such as kidney and liver and mucosal tissues[1][2][3].
The amino acid sequence of human IL-17RB protein has low homology with mouse IL-17B protein.
IL-17RB has a SEFIR cytoplasmic domain implicated in homotypic dimerization and recruitment of signaling proteins (shared with IL-17RA) and a TRAF6-binding domain (not found in IL-17RA). IL-17B shares its receptor IL-17RB with IL-17E (also known as IL-25) that binds to the heterodimeric IL-17RA/IL-17RB complex. The binding affinity (KD) of IL-17B for IL-17RB is around 30-fold lower than that of IL-17E. It does not bind IL-17, IL-17C and IL-17F. Interleukin-17 (IL-17) plays a pivotal role in inflammatory diseases and cancers. IL-17 acts its role through IL-17 receptor (IL-17R). The IL-17R family are single transmembrane proteins that include the subtype receptors of IL-17RA to IL-17RE. Upon ligand binding, IL-17RB activates the canonical NK-κB pathway as well as ERK, JNK, and p38. Moreover, TRAF6 binds to IL-17RB independently of its ligand and participates in IL-17RB-dependent NF-κB activation[1][2][3].
It is reported that IL-17RB expression is significantly increased in gastric cancer tissues. Moreover, overexpression of IL-17RB is strongly associated with metastasis and inversely correlates with progression-free survival in pancreatic cancer. IL-17RB can enhance thyroid cancer cell invasion and metastasis via ERK1/2 pathway-mediated MMP-9 expression[1]. By using a rodent ortholog of IL-17BR as a probe, IL-17BR message was found to be drastically up-regulated during intestinal inflammation elicited by indomethacin treatment in rats[2]. IL-17RB expression in human innate type 2 lymphocytes, natural killer T (NKT) cells, and Th2 cells suggests a potential role in immune cells[3].

Biological Activity

Immobilized Recombinant Human IL-17E at 0.5 μg/mL (100 μL/well) can bind Biotinylated Recombinant Rhesus IL-17RB. The ED50 for this effect is 11.07 ng/mL.

  • Immobilized Recombinant Human IL-17E at 0.5 μg/ml (100 μL/well) can bind Biotinylated Recombinant Rhesus IL-17RB. The ED50 for this effect is 11.07 ng/mL.
Species

Rhesus Macaque

Source

HEK293

Tag

C-6*His

Accession

G7ML21/EHH16291.1 (R18-G288)

Gene ID

693671  [NCBI]

Molecular Construction
N-term
IL-17RB (R18-G288)
Accession # G7ML21/EHH16291.1
His
C-term
Synonyms
Interleukin-17 receptor B; IL-17RB; IL-17Rh1; IL-17B receptor; CRL4; EVI27
AA Sequence

REPTVQCGSETGPSPEWMLQHDLTPGDLRDLRVEPVKTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSLNFTSPGCLDHIMKYKKKCVKAGSLWDPNITACKKNEETVEVNFTTSPLGNRYMALIQHSTIIGFSQVSEPYQNKQTRASVVIPVTEESEGAMVQLTPYFPTCGSDCIRHKGTVVLCPQTGVPFPLDNNRSKPG

Molecular Weight

Approximately 40-50 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-17RB Protein, Rhesus Macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-17RB Protein, Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P77404
Quantity:
MCE Japan Authorized Agent: