1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-12
  5. IL-12 Protein, Human (HEK293, His, Flag)

IL-12 Protein, Human (HEK293, His, Flag)

Cat. No.: HY-P700462
Handling Instructions

IL-12 beta protein is a multifunctional cytokine that serves as a growth factor for activated T cells and NK cells, amplifies the lytic activity of NK/lymphokine-activated killer cells, and induces IFN production by resting peripheral blood mononuclear cells -γ. peripheral blood mononuclear cells). IL-12 Protein, Human (HEK293, His, Flag) is a recombinant protein dimer complex containing human-derived IL-12 beta & IL-12 alpha Heterodimer protein, expressed by HEK293 , with C-10*His, C-Flag labeled tag. IL-12 Protein, Human (HEK293, His, Flag), has molecular weight of 39.7 kDa & 27.2 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-12 beta protein is a multifunctional cytokine that serves as a growth factor for activated T cells and NK cells, amplifies the lytic activity of NK/lymphokine-activated killer cells, and induces IFN production by resting peripheral blood mononuclear cells -γ. peripheral blood mononuclear cells). IL-12 Protein, Human (HEK293, His, Flag) is a recombinant protein dimer complex containing human-derived IL-12 beta & IL-12 alpha Heterodimer protein, expressed by HEK293 , with C-10*His, C-Flag labeled tag. IL-12 Protein, Human (HEK293, His, Flag), has molecular weight of 39.7 kDa & 27.2 kDa.

Background

IL-12 beta Protein, a multifunctional cytokine, serves as a growth factor for activated T and NK cells, amplifies the lytic activity of NK/lymphokine-activated killer cells, and induces the production of IFN-gamma by resting peripheral blood mononuclear cells (PBMC). When combined with IL23A, it forms the heterodimeric cytokine IL-23, which plays a pivotal role in both innate and adaptive immunity. This cytokine acts by binding to a receptor complex consisting of IL12RB1 and IL23R, initiating the Jak-Stat signaling cascade. Notably, IL-23 preferentially activates memory T-cells over naive T-cells and fosters the production of pro-inflammatory cytokines. The association of IL-23 with autoimmune inflammation suggests its potential involvement in autoimmune inflammatory diseases and underscores its significance in tumorigenesis.

Species

Human

Source

HEK293

Tag

C-10*His;C-Flag

Accession

P29460 (I23-S328) & P29459 (R23-S219)

Gene ID

3593&3592

Molecular Construction
N-term
IL12B (I23-S328)
Accession # P29460
10*His
C-term
N-term
IL12A (R23-S219)
Accession # P29459
Flag
C-term
Synonyms
Cytotoxic lymphocyte maturation factor; CLMF; IL-12; NK cell stimulatory factor; NKSF
AA Sequence

IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS&RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

Molecular Weight

39.7 kDa & 27.2 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

IL-12 Protein, Human (HEK293, His, Flag) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-12 Protein, Human (HEK293, His, Flag)
Cat. No.:
HY-P700462
Quantity:
MCE Japan Authorized Agent: