1. Recombinant Proteins
  2. Receptor Proteins
  3. Cell Adhesion Molecules (CAMs)
  4. HEPACAM Protein, Human (HEK293, His)

HEPACAM Protein, Human (HEK293, His)

Cat. No.: HY-P70838
COA Handling Instructions

HEPACAM proteins are key regulators of cell motility, interacting with the extracellular matrix to inhibit cell growth and maintain cellular homeostasis. HEPACAM forms homodimers through cis interactions, is a component of the MLC1, TRPV4, AQP4 and ATP1B1 complexes and participates in key molecular interactions. HEPACAM Protein, Human (HEK293, His) is the recombinant human-derived HEPACAM protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $155 In-stock
50 μg $430 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HEPACAM proteins are key regulators of cell motility, interacting with the extracellular matrix to inhibit cell growth and maintain cellular homeostasis. HEPACAM forms homodimers through cis interactions, is a component of the MLC1, TRPV4, AQP4 and ATP1B1 complexes and participates in key molecular interactions. HEPACAM Protein, Human (HEK293, His) is the recombinant human-derived HEPACAM protein, expressed by HEK293 , with C-6*His labeled tag.

Background

HEPACAM protein emerges as a key regulator in the intricate orchestration of cell motility and interactions with the extracellular matrix. It exhibits the potential to curb cell growth by suppressing proliferation, suggesting a role in maintaining cellular homeostasis. The protein forms homodimers, with dimerization predominantly occurring through cis interactions on the cell surface. Notably, it is integral to a complex that includes MLC1, TRPV4, AQP4, and ATP1B1, highlighting its participation in a network of molecular interactions crucial for various cellular processes. The multifaceted involvement of HEPACAM underscores its significance in the intricate landscape of cellular dynamics and growth regulation.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q14CZ8-1/NP_689935.2 (V34-S240)

Gene ID
Molecular Construction
N-term
HEPACAM (V34-S240)
Accession # Q14CZ8-1/NP_689935.2
6*His
C-term
Synonyms
Hepatocyte Cell Adhesion Molecule; Protein HepaCAM; HEPACAM
AA Sequence

VNITSPVRLIHGTVGKSALLSVQYSSTSSDRPVVKWQLKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTTVLELSEAFTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQKVLTITRVLMEDDDLYSCMVENPISQGRSLPVKITVYRRSS

Molecular Weight

35-45 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

HEPACAM Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HEPACAM Protein, Human (HEK293, His)
Cat. No.:
HY-P70838
Quantity:
MCE Japan Authorized Agent: