1. Recombinant Proteins
  2. Receptor Proteins
  3. Growth Hormone R/GHR Protein, Rhesus macaque (HEK293, Fc)

Growth Hormone R/GHR Protein, Rhesus macaque (HEK293, Fc)

Cat. No.: HY-P78726
COA Handling Instructions

GHR Protein, a cell surface receptor, is involved in growth regulation and metabolism. Dysregulation of GHR Protein has been linked to conditions such as growth hormone deficiency and metabolic disorders. Targeting GHR Protein may offer potential therapeutic interventions in these conditions by regulating growth, improving metabolism, and managing related disorders. Growth Hormone R/GHR Protein, Rhesus macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $41 In-stock
10 μg $69 In-stock
50 μg $194 In-stock
100 μg $330 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GHR Protein, a cell surface receptor, is involved in growth regulation and metabolism. Dysregulation of GHR Protein has been linked to conditions such as growth hormone deficiency and metabolic disorders. Targeting GHR Protein may offer potential therapeutic interventions in these conditions by regulating growth, improving metabolism, and managing related disorders. Growth Hormone R/GHR Protein, Rhesus macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The GHR protein, a receptor for pituitary gland growth hormone, plays a crucial role in regulating postnatal body growth. Upon binding to its ligand, GHR activates the JAK2/STAT5 pathway, thereby initiating downstream signaling events. Additionally, the soluble form of GHR, known as GHBP, functions as a reservoir for growth hormone in the plasma and may serve as a modulator or inhibitor of GH signaling.

Biological Activity

Measured in a cell proliferation assay using NB2-11 cells. The ED50 for this effect is 0.8665 ng/mL in the presence of 0.2 ng/mL of rhGH, corresponding to a specific activity is 1.15×10^6 units/mg.

  • Measured in a cell proliferation assay using NB2-11 cells. The ED50 this effect is 0.8665 ng/mL in the presence of 0.2 ng/mL of rhGH, corresponding to a specific activity is 1.15×106units/mg
Species

Rhesus Macaque

Source

HEK293

Tag

C-hFc

Accession

P79194 (F19-Y264)

Gene ID

697986  [NCBI]

Molecular Construction
N-term
GHR (F19-Y264)
Accession # P79194
hFc
C-term
Synonyms
GHR; GHBP; GH receptor
AA Sequence

FSGSEPTAAILSRASWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDAVHHGSKSLGPIQLFYTRRNIQGQTQEWKECPDYVSAGENSCYFNSSFTSVWIPYCIKLTSNGDTVDGKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADILVRWEAPPNADIQKGWMVLEYELQYKEVNETKWKMMDPILSTSVPVYSLKVDKEYEVLVRSKRRNSRNYGEFSEVLYVTLPQMNQFTCEEDFY

Molecular Weight

65-93 kDa band in SDS-PAGE under reducing conditions due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of 100 mM Glycine, 25 mM Arginine, 150 mM NaCl, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Growth Hormone R/GHR Protein, Rhesus macaque (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Growth Hormone R/GHR Protein, Rhesus macaque (HEK293, Fc)
Cat. No.:
HY-P78726
Quantity:
MCE Japan Authorized Agent: