1. Recombinant Proteins
  2. Others
  3. Galectin-14/LGALS14 Protein, Human (HEK293, His)

Galectin-14/LGALS14 Protein, Human (HEK293, His)

Cat. No.: HY-P70159
Handling Instructions

PPL13/LGALS14 is a mammalian placenta-specific galectin with placental specificity. Many placental lectins induce apoptosis of activated T cells and other leukocytes, thereby conferring immune tolerance to the recipient. Galectin-14/LGALS14 Protein, Human (HEK293, His) is the recombinant human-derived Galectin-14/LGALS14 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PPL13/LGALS14 is a mammalian placenta-specific galectin with placental specificity. Many placental lectins induce apoptosis of activated T cells and other leukocytes, thereby conferring immune tolerance to the recipient. Galectin-14/LGALS14 Protein, Human (HEK293, His) is the recombinant human-derived Galectin-14/LGALS14 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

PPL13/LGALS14 belongs to the placenta-specific protein family and are proteins secreted by the placenta into the maternal circulation. Human placenta-specific galectin is primarily expressed by the syncytiotrophoblast, the primary site of metabolic exchange. Early in pregnancy, the fetus comes into contact with immune cells circulating in the maternal blood. In ex vivo functional assays, placenta-specific galectin was found to induce T lymphocyte apoptosis, so galectin may reduce the risk of maternal immune attack on fetal semi-allografts and may confer additional immune tolerance. Mechanisms that maintain the hemorrhagic placenta during long gestations in humanoid primates. However, these proteins are reduced along with abnormal placenta before the onset of intrauterine growth restriction (IUGR) or preeclampsia (PE). PPL13 is highly expressed in pregnancies complicated by PE and IUGR. The PPL13 protein binds β-galactoside and lactose and is a strong inducer of T cell apoptosis.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

AAH22257.1 (M1-D139)

Gene ID

56891  [NCBI]

Molecular Construction
N-term
LGALS14 (M1-D139)
Accession # AAH22257.1
6*His
C-term
Synonyms
rHuPlacental protein 13-like/LGALS14, His; Placental Protein 13-Like; Charcot-Leyden Crystal Protein 2; CLC2; Galectin-14; Gal-14; LGALS14; PPL13
AA Sequence

MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD

Molecular Weight

Approximately 16.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Galectin-14/LGALS14 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Galectin-14/LGALS14 Protein, Human (HEK293, His)
Cat. No.:
HY-P70159
Quantity:
MCE Japan Authorized Agent: