1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. DCD Protein, Human (P.pastoris, His)

DCD Protein, Human (P.pastoris, His)

Cat. No.: HY-P71729
COA Handling Instructions

N-6*His;Accession#P81605-1 DCD (Y20-L110)

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $158 In-stock
10 μg $269 In-stock
50 μg $753 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

N-6*His;Accession#P81605-1 DCD (Y20-L110)

Background

DCD protein, found in sweat, demonstrates antimicrobial activity during the early stages of bacterial colonization. The secreted peptide forms homohexameric complexes capable of associating with and inserting into pathogen membranes. Upon insertion into bacterial membranes, DCD protein creates anion channels, potentially altering the transmembrane potential crucial for bacterial survival. It exhibits high efficacy against various pathogens, including E. coli, E. faecalis, S. aureus, and C. albicans. Operating optimally under conditions resembling those in sweat, DCD protein also displays proteolytic activity, with a preference for cleaving on the C-terminal side of Arg and, to a lesser extent, Lys residues. Additionally, DCD protein promotes neuron survival and exhibits phosphatase activity, suggesting a multifaceted role in host defense mechanisms. Furthermore, it may have the ability to bind to IgG.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

P. pastoris

Tag

N-6*His

Accession

P81605-1 (Y20-L110)

Gene ID
Molecular Construction
N-term
C-term
Synonyms
AIDD ; DCD 1; dcd; DCD-1; DCD_HUMAN; Dermcidin; DSEP; HCAP; PIF; Preproteolysin
AA Sequence

YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL

Molecular Weight

Approximately 17 kDa. The reducing (R) protein migrat es as 17 kDa in SDS-PAGE may be due to relative charge.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

DCD Protein, Human (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DCD Protein, Human (P.pastoris, His)
Cat. No.:
HY-P71729
Quantity:
MCE Japan Authorized Agent: