1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins
  4. IREM-1/CD300f
  5. CD300LF Protein, Human (His)

CD300LF Protein, Human (His)

Cat. No.: HY-P71595
COA Handling Instructions

N-6*His;Accession#Q8TDQ1-1 CD300LF (T20-S156)

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $97 In-stock
10 μg $165 In-stock
50 μg $460 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

N-6*His;Accession#Q8TDQ1-1 CD300LF (T20-S156)

Background

CD300LF protein serves as a multifaceted regulator within the immune system, acting as an inhibitory receptor for myeloid cells and mast cells. It plays a pivotal role in immune homeostasis by positively regulating the phagocytosis of apoptotic cells, or efferocytosis, through recognition and binding to phosphatidylserine (PS) on the surface of apoptotic cells. CD300LF also functions as a negative regulator of Fc epsilon receptor-dependent mast cell activation and allergic responses by binding to ceramide and sphingomyelin. Furthermore, it may act as a coreceptor for interleukin 4 (IL-4), enhancing IL-4- and IL-13-induced signaling (By similarity). CD300LF negatively regulates Toll-like receptor (TLR) signaling mediated by MYD88 and TRIF through the activation of phosphatases PTPN6/SHP-1 and PTPN11/SHP-2. Additionally, it inhibits osteoclast formation and induces macrophage cell death upon engagement (By similarity). The protein interacts with PTPN6/SHP-1 in a tyrosine phosphorylation-dependent manner and associates with IL4R (By similarity).

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q8TDQ1-1 (T20-S156)

Gene ID
Molecular Construction
N-term
C-term
Synonyms
CD300 antigen like family member; CD300 antigen-like family member F; CD300 molecule like family member f; CD300f; CD300LF; CLM; CLM-1; CLM1; CMRF35-like molecule 1; IGSF; IgSF13; Inhibitory receptor IREM1; IREM; IREM-1; IREM1; Nepmucin; NK inhibitory receptor; NKIR; TREM
AA Sequence

TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS

Molecular Weight

Approximately 21 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD300LF Protein, Human (His)
Cat. No.:
HY-P71595
Quantity:
MCE Japan Authorized Agent: