1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. TGF-beta Superfamily Neurotrophic Factors
  4. GDNF family
  5. Neurturin
  6. Animal-Free Neurturin Protein, Mouse (His)

Animal-Free Neurturin Protein, Mouse (His)

Cat. No.: HY-P700224AF
COA Handling Instructions

Neurturin, forming homodimers through disulfide links, promotes the survival of sympathetic neurons in culture. It potentially plays a role in regulating the development and maintenance of the central nervous system (CNS) and influencing the size of non-neuronal cell populations, such as haemopoietic cells. Animal-Free Neurturin Protein, Mouse (His) is the recombinant mouse-derived animal-FreeNeurturin protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free Neurturin Protein, Mouse (His) is 100 a.a., with molecular weight of ~12.33 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
2 μg $45 In-stock
10 μg $125 In-stock
50 μg $350 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Neurturin, forming homodimers through disulfide links, promotes the survival of sympathetic neurons in culture. It potentially plays a role in regulating the development and maintenance of the central nervous system (CNS) and influencing the size of non-neuronal cell populations, such as haemopoietic cells. Animal-Free Neurturin Protein, Mouse (His) is the recombinant mouse-derived animal-FreeNeurturin protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free Neurturin Protein, Mouse (His) is 100 a.a., with molecular weight of ~12.33 kDa.

Background

Neurturin, a crucial factor in neuronal support, plays a pivotal role in fostering the survival of sympathetic neurons in cultured environments. Its potential extends beyond neuronal realms, as it is implicated in the regulation of central nervous system (CNS) development and maintenance. Additionally, Neurturin exhibits the capacity to influence the size of non-neuronal cell populations, including but not limited to haemopoietic cells. Structurally, Neurturin manifests as a homodimer, connected through disulfide linkages, accentuating its role as a multifaceted player in cellular homeostasis and development.

Biological Activity

Measure by its ability to induce proliferation in SH-SY5Y cells. The ED50 for this effect is <50 ng/mL.

Species

Mouse

Source

E. coli

Tag

N-His

Accession

P97463.1 (P96-V195)

Gene ID

18188  [NCBI]

Molecular Construction
N-term
His
Neurturin (P96-V195)
Accession # P97463.1
C-term
Synonyms
NTN; NRTN
AA Sequence

PGARPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV

Molecular Weight

Approximately 12.33 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free Neurturin Protein, Mouse (His)
Cat. No.:
HY-P700224AF
Quantity:
MCE Japan Authorized Agent: