1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. TGF-beta Superfamily Neurotrophic Factors
  4. GDNF family
  5. Neurturin
  6. Animal-Free Neurturin Protein, Human (His)

Animal-Free Neurturin Protein, Human (His)

Cat. No.: HY-P700142AF
COA Handling Instructions

Neurturin protein, vital in neurobiology, is key to supporting sympathetic neuron survival and implicated in regulating the central nervous system (CNS). It influences neural growth, stability, and may modulate non-neuronal cell populations. Neurturin, a homodimer linked by disulfide bonds, maintains structural integrity for diverse cellular functions beyond neuronal survival. Animal-Free Neurturin Protein, Human (His) is the recombinant human-derived animal-FreeNeurturin protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free Neurturin Protein, Human (His) is 102 a.a., with molecular weight of ~12.62 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $54 In-stock
10 μg $150 In-stock
50 μg $420 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Neurturin protein, vital in neurobiology, is key to supporting sympathetic neuron survival and implicated in regulating the central nervous system (CNS). It influences neural growth, stability, and may modulate non-neuronal cell populations. Neurturin, a homodimer linked by disulfide bonds, maintains structural integrity for diverse cellular functions beyond neuronal survival. Animal-Free Neurturin Protein, Human (His) is the recombinant human-derived animal-FreeNeurturin protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free Neurturin Protein, Human (His) is 102 a.a., with molecular weight of ~12.62 kDa.

Background

Neurturin protein, a vital factor in neurobiology, plays a key role in supporting the survival of sympathetic neurons in culture. Beyond its role in neuronal survival, Neurturin is suggested to have regulatory functions in the development and maintenance of the central nervous system (CNS), influencing the intricate processes governing neural growth and stability. Additionally, there is a potential involvement in modulating the size of non-neuronal cell populations, such as haemopoietic cells, underscoring its broader impact on cellular dynamics. Neurturin functions as a homodimer, held together by disulfide linkages, emphasizing its structural integrity in executing its diverse cellular functions.

Biological Activity

Measure by its ability to induce proliferation in SH-SY5Y cells. The ED50 for this effect is <50 ng/mL.

Species

Human

Source

E. coli

Tag

C-His

Accession

Q99748 (A96-V197)

Gene ID
Molecular Construction
N-term
Neurturin (A96-V197)
Accession # Q99748
His
C-term
Synonyms
Neurturin; NRTN
AA Sequence

MARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV

Molecular Weight

Approximately 12.62 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free Neurturin Protein, Human (His)
Cat. No.:
HY-P700142AF
Quantity:
MCE Japan Authorized Agent: