1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. TNF Superfamily
  4. TNF Superfamily Ligands
  5. LIGHT Proteins
  6. Animal-Free LIGHT/TNFSF14 Protein, Mouse (His)

Animal-Free LIGHT/TNFSF14 Protein, Mouse (His)

Cat. No.: HY-P700221AF
COA Handling Instructions

LIGHT/TNFSF14 protein (CD258; TNFRSF14) is a type II transmembrane protein produced by activated T cells. It is a TNFRSF14/HVEM ligand and belongs to the tumor necrosis factor (TNF) family. LIGHT/TNFSF14 is mainly expressed in spleen, with two subtypes: membrane-bound type and soluble type . LIGHT/TNFSF14 protein can be used as immune checkpoint molecule of tumor, and stimulate natural killer cells to produce interferon TFNγ, triggering tumor apoptosis signal . LIGHT/TNFSF14 is also involved in the dominant LTβR-NIK-p52 NF-κB pathway promoting the expression of inflammatory gene. In addition, LIGHT/TNFSF14 protein is a co-stimulatory factor that activates lymphoid cells and has an inhibitory effect on herpes virus infection. Mouse LIGHT/TNFSF14 Protein has 239 amino acids and a transmembrane domain (38-58 a.a.). Animal-Free LIGHT/TNFSF14 Protein, Mouse (His) is the extracellular part (R58-V239) of mouse LIGHT/TNFSF14 Protein, produced by E.coli, with C-terminal His-tag.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $50 In-stock
10 μg $140 In-stock
50 μg $400 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

LIGHT/TNFSF14 protein (CD258; TNFRSF14) is a type II transmembrane protein produced by activated T cells. It is a TNFRSF14/HVEM ligand and belongs to the tumor necrosis factor (TNF) family. LIGHT/TNFSF14 is mainly expressed in spleen, with two subtypes: membrane-bound type and soluble type [1]. LIGHT/TNFSF14 protein can be used as immune checkpoint molecule of tumor, and stimulate natural killer cells to produce interferon TFNγ, triggering tumor apoptosis signal [2]. LIGHT/TNFSF14 is also involved in the dominant LTβR-NIK-p52 NF-κB pathway promoting the expression of inflammatory gene[3]. In addition, LIGHT/TNFSF14 protein is a co-stimulatory factor that activates lymphoid cells and has an inhibitory effect on herpes virus infection[4]. Mouse LIGHT/TNFSF14 Protein has 239 amino acids and a transmembrane domain (38-58 a.a.). Animal-Free LIGHT/TNFSF14 Protein, Mouse (His) is the extracellular part (R58-V239) of mouse LIGHT/TNFSF14 Protein, produced by E.coli, with C-terminal His-tag.

Background

LIGHT/TNFSF14 is a type II transmembrane protein produced by activated T cells, belongs to tumor necrosis factor (TNF) family. LIGHT/TNFSF14 is a TNFRSF14/HVEM (herpesvirus entry mediator) ligand, engages the receptor for the LTalphabeta heterotrimer but does not form complexes with either secreted lymphotoxin alpha (LTalpha) or LTbeta[1].
LIGHT/TNFSF14 is predominantly expressed in the spleen but also found in the brain. It is weakly expressed in peripheral lymphoid tissues and in heart, placenta, liver, lung, appendix, and kidney, and no expression seen in fetal tissues, endocrine glands, or nonhematopoietic tumor lines[1].
LIGHT/TNFSF14 has a transmemberane, thus it can be leaved into 2 chains: membrane form and soluble form. The soluble form of isoform 1 derives from the membrane form by proteolytic processing.
In tumor immunology, TNFSF14/LIGHT also serves as a novel immune checkpoint molecule for glioblastoma multiforme (GBM), as well as lung carcinoma, breast carcinoma, cervical cancer, and prostate cancer. TNFSF14/LIGHT can stimulate NK cells to produce IFNγ via nuclear factor-κB (NFκB) RelA/p50 signaling. TNFSF14/LIGHT sustains the function of CD8+ effector T cells, trigger apoptosis of various tumor cells[2].
In cell signaling, TNFSF14/LIGHT binds to lymphotoxin-β receptor (LTβR) and HVEM for activating both of them, and disrupts the HVEM-BTLA complex in surface-bound form, and facilitates HVEM-BTLA complex formation in the soluble form[2].
TNFSF14/LIGHT promotes an inflammatory esophageal fibroblast in vitro via a LTβR-NIK-p52 NF-κB dominant pathway with promoting inflammatory gene expression and down-regulating homeostatic factors including WNTs, BMPs and type 3 semaphorins[3].
Beside that, TNFSF14/LIGHT protein is a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. TNFSF14/LIGHT also prevents tumor necrosis factor alpha mediated apoptosis in primary hepatocyte[4][5].

In Vitro

LIGHT/TNFSF14 is homologous to lymphotoxins, exhibits inducible expression, and competes with HSV glycoprotein D for herpes virus entry mediator (HVEM), a receptor expressed by T lymphocytes[8].
LIGHT/TNFSF14 transgenic expression on T cells in mice promotes inflammation in multiple organs, including intestine[8].
LIGHT/TNFSF14-/- mice also shows increased accumulation of innate immune cells and higher levels of cytokines than colons from control mice, indicating a function for inflammation regulation in the colon[8].

In Vivo

LIGHT/TNFSF14 (mouse; 2 μg/mL; 48 h) promotes insulin signalling in L6 skeletal muscle myotubes as indicated by increased expression of phospho-AKT[6].
LIGHT/TNFSF14 (mouse; 1 ng/mL; 24 h) reduces palmitate-induced insulin resistance and promotes insulin secretion in vitro[7].

Biological Activity

Measure by its ability to induce cytotoxicity in HT-29 cells. The ED50 for this effect is <2 μg/mL.

Species

Mouse

Source

E. coli

Tag

C-His

Accession

Q9QYH9 (R58-V239)

Gene ID

50930  [NCBI]

Molecular Construction
N-term
LIGHT (R58-V239)
Accession # Q9QYH9
His
C-term
Synonyms
Tumor necrosis factor ligand superfamily member 14; TNFSF14; HVEM-L; LIGHT  
AA Sequence

MRLHQRLGDIVAHLPDGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAFLRGLTYHDGALVTMEPGYYYVYSKVQLSGVGCPQGLANGLPITHGLYKRTSRYPKELELLVSRRSPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFMV

Molecular Weight

Approximately 20.92 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
References

Animal-Free LIGHT/TNFSF14 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free LIGHT/TNFSF14 Protein, Mouse (His)
Cat. No.:
HY-P700221AF
Quantity:
MCE Japan Authorized Agent: