1. Recombinant Proteins
  2. Others Animal-free Recombinant Proteins
  3. Animal-Free HMGB2/HMG-2 Protein, Human (His)

Animal-Free HMGB2/HMG-2 Protein, Human (His)

Cat. No.: HY-P700088AF
COA Handling Instructions

The multifunctional HMGB2/HMG-2 protein exhibits multiple cellular functions and may function in a redox-sensitive manner. In the nucleus, it acts as a chromatin-associated non-histone protein that is essential for transcription, chromatin remodeling and V(D)J reorganization. Animal-Free HMGB2/HMG-2 Protein, Human (His) is the recombinant human-derived animal-FreeHMGB2/HMG-2 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free HMGB2/HMG-2 Protein, Human (His) is 209 a.a., with molecular weight of ~24.84 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $65 In-stock
10 μg $175 In-stock
50 μg $500 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The multifunctional HMGB2/HMG-2 protein exhibits multiple cellular functions and may function in a redox-sensitive manner. In the nucleus, it acts as a chromatin-associated non-histone protein that is essential for transcription, chromatin remodeling and V(D)J reorganization. Animal-Free HMGB2/HMG-2 Protein, Human (His) is the recombinant human-derived animal-FreeHMGB2/HMG-2 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free HMGB2/HMG-2 Protein, Human (His) is 209 a.a., with molecular weight of ~24.84 kDa.

Background

HMGB2/HMG-2, a versatile protein with diverse cellular functions across various compartments, may act in a redox-sensitive manner. In the nucleus, it serves as an abundant chromatin-associated non-histone protein, playing crucial roles in transcription, chromatin remodeling, and V(D)J recombination, among other processes. HMGB2/HMG-2 exhibits a DNA-binding preference for non-canonical DNA structures, such as single-stranded DNA, and possesses the ability to bend DNA, enhancing flexibility through looping. This looping mechanism facilitates the promotion of activities on various gene promoters by augmenting transcription factor binding and bringing distant regulatory sequences into close proximity. Involved in V(D)J recombination, HMGB2/HMG-2 acts as a cofactor of the RAG complex, stimulating cleavage and RAG protein binding at the conserved recombination signal sequences. Additionally, it is proposed to participate in the innate immune response to nucleic acids by acting as a promiscuous immunogenic DNA/RNA sensor, cooperating with subsequent discriminative sensing by specific pattern recognition receptors. In the extracellular compartment, HMGB2/HMG-2 acts as a chemokine, promoting proliferation and migration of endothelial cells and exhibiting antimicrobial activity in gastrointestinal epithelial tissues. It is implicated in inflammatory responses to antigenic stimuli and involved in the modulation of neurogenesis, likely by regulating neural stem proliferation. Furthermore, HMGB2/HMG-2 contributes to articular cartilage surface maintenance through interactions with LEF1 and the Wnt/beta-catenin pathway. It interacts with various proteins, including POU2F2, POU2F1, POU3F1, SET, and LEF1, highlighting its intricate role in diverse cellular processes.

Species

Human

Source

E. coli

Tag

C-His

Accession

P26583 (M1-E209)

Gene ID
Molecular Construction
N-term
HMGB2 (M1-E209)
Accession # P26583
His
C-term
Synonyms
High Mobility Group Protein B2; High Mobility Group Protein 2; HMG-2; HMGB2; HMG2
AA Sequence

MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE

Molecular Weight

Approximately 24.84 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Animal-Free HMGB2/HMG-2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free HMGB2/HMG-2 Protein, Human (His)
Cat. No.:
HY-P700088AF
Quantity:
MCE Japan Authorized Agent: