1. Protein Tyrosine Kinase/RTK
  2. Insulin Receptor
  3. (Pro3) GIP, human

(Pro3) GIP, human  (Synonyms: (Pro3) Gastric Inhibitory Peptide, human)

Cat. No.: HY-P3584
COA Handling Instructions

(Pro3) GIP, human ((Pro3) Gastric Inhibitory Peptide, human) is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human has high binding affinity for human GIPR with Ki/ Kd values of 0.90 nM. (Pro3) GIP, human can be used for the research of obesity-related diabetes.

For research use only. We do not sell to patients.

(Pro3) GIP, human Chemical Structure

(Pro3) GIP, human Chemical Structure

CAS No. : 299898-52-5

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of (Pro3) GIP, human:

Other Forms of (Pro3) GIP, human:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

(Pro3) GIP, human ((Pro3) Gastric Inhibitory Peptide, human) is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human has high binding affinity for human GIPR with Ki/ Kd values of 0.90 nM. (Pro3) GIP, human can be used for the research of obesity-related diabetes[1][2].

IC50 & Target

EC50: 0.026 nM (hGIPR)[2]
Ki/Kd: 0.90 nM (hGIPR); 1.1 nM (Rat GIPR); 0.72 nM (Mouse GIPR)[2]

In Vitro

(Pro3) GIP, human induces cAMP accumulation with an EC50 value of 0.026 nM[2].
(Pro3) GIP, human has high binding affinity for human GIPR, Rat GIPR and Mouse GIPR with Ki/ Kd values of 0.90 nM, 1.1 nM and 0.72 nM, respectively[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

(Pro3) GIP, human has comparatively weak partial agonist effect in rodent models[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4951.53

Formula

C226H338N60O64S

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln

Sequence Shortening

YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

SMILES

O=C(N[C@@H](C)C(N1[C@@H](CCC1)C(NCC(N[C@@H]([C@H](O)C)C(N[C@@H](CC2=CC=CC=C2)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CO)C(N[C@@H](CC(O)=O)C(N[C@@H](CC3=CC=C(C=C3)O)C(N[C@@H](CO)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](C)C(N[C@@H](CCSC)C(N[C@@H](CC(O)=O)C(N[C@@H](CCCCN)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC4=CNC=N4)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCC(N)=O)C(N[C@@H](CC(O)=O)C(N[C@@H](CC5=CC=CC=C5)C(N[C@@H](C(C)C)C(N[C@@H](CC(N)=O)C(N[C@@H](CC6=CNC7=CC=CC=C67)C(N[C@@H](CC(C)C)C(N[C@@H](CC(C)C)C(N[C@@H](C)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCCN)C(NCC(N[C@@H](CCCCN)C(N[C@@H](CCCCN)C(N[C@@H](CC(N)=O)C(N[C@@H](CC(O)=O)C(N[C@@H](CC8=CNC9=CC=CC=C89)C(N[C@@H](CCCCN)C(N[C@@H](CC%10=CNC=N%10)C(N[C@@H](CC(N)=O)C(N[C@@H]([C@@H](C)CC)C(N[C@@H]([C@H](O)C)C(N[C@@H](CCC(N)=O)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC%11=CC=C(C=C%11)O)N

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
(Pro3) GIP, human
Cat. No.:
HY-P3584
Quantity:
MCE Japan Authorized Agent: