1. Cytoskeleton
  2. Integrin
  3. Obtustatin triacetate

Obtustatin triacetate is a 41-residue non-RGD disintegrin. Obtustatin triacetate can be isolated from the venom of Vipera lebetina obtusa. Obtustatin triacetate is a potent and selective inhibitor of integrin α1β1 adhesion to type IV collagen. Obtustatin triacetate inhibits angiogenesis and may be used in cancer research.

For research use only. We do not sell to patients.

Obtustatin triacetate Chemical Structure

Obtustatin triacetate Chemical Structure

Size Price Stock Quantity
1 mg USD 295 In-stock
5 mg USD 890 In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Obtustatin triacetate:

Top Publications Citing Use of Products

View All Integrin Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Obtustatin triacetate is a 41-residue non-RGD disintegrin. Obtustatin triacetate can be isolated from the venom of Vipera lebetina obtusa. Obtustatin triacetate is a potent and selective inhibitor of integrin α1β1 adhesion to type IV collagen. Obtustatin triacetate inhibits angiogenesis and may be used in cancer research[1].

Molecular Weight

4573.21

Formula

C184H284N52O57S8.3C2H4O2

Appearance

Solid

Color

White to off-white

Sequence

Cys-Thr-Thr-Gly-Pro-Cys-Cys-Arg-Gln-Cys-Lys-Leu-Lys-Pro-Ala-Gly-Thr-Thr-Cys-Trp-Lys-Thr-Ser-Leu-Thr-Ser-His-Tyr-Cys-Thr-Gly-Lys-Ser-Cys-Asp-Cys-Pro-Leu-Tyr-Pro-Gly (Disulfide bridge: Cys1-Cys10, Cys6-Cys29, Cys7-Cys34, Cys19-Cys36)

Sequence Shortening

CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG (Disulfide bridge: Cys1-Cys10, Cys6-Cys29, Cys7-Cys34, Cys19-Cys36)

SMILES

O=C([C@@H](N)CSSC[C@H](NC1=O)C(N[C@H](C(N[C@H](C(N[C@H](C(N2[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H]3CC4=CC=C(O)C=C4)=O)CC5=CNC=N5)=O)CO)=O)[C@@H](C)O)=O)CC(C)C)=O)CO)=O)[C@@H](C)O)=O)CCCCN)=O)CC6=CNC7=CC=CC=C67)=O)CSSC[C@H](NC8=O)C(N9[C@H](C(N[C@H](C(N[C@H](C(N%10[C@H](C(NCC(O)=O)=O)CCC%10)=O)CC%11=CC=C(O)C=C%11)=O)CC(C)C)=O)CCC9)=O)=O)[C@@H](C)O)=O)[C@@H](C)O)=O)=O)C)=O)CCC2)=O)CCCCN)=O)CC(C)C)=O)CCCCN)=O)N[C@H](C(N[C@H](C(NCC(N%12[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H]1CCC(N)=O)=O)CCCNC(N)=N)=O)CSSC[C@H](NC%13=O)C(N[C@H]8CC(O)=O)=O)=O)CSSC[C@H](NC3=O)C(N[C@H](C(NCC(NC(C(NC%13CO)=O)CCCCN)=O)=O)[C@@H](C)O)=O)=O)CCC%12)=O)=O)[C@@H](C)O)=O)[C@@H](C)O.CC(O)=O.CC(O)=O.CC(O)=O

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (21.87 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2187 mL 1.0933 mL 2.1866 mL
5 mM 0.0437 mL 0.2187 mL 0.4373 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation

Purity: 99.66%

References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.2187 mL 1.0933 mL 2.1866 mL 5.4666 mL
5 mM 0.0437 mL 0.2187 mL 0.4373 mL 1.0933 mL
10 mM 0.0219 mL 0.1093 mL 0.2187 mL 0.5467 mL
15 mM 0.0146 mL 0.0729 mL 0.1458 mL 0.3644 mL
20 mM 0.0109 mL 0.0547 mL 0.1093 mL 0.2733 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Obtustatin triacetate
Cat. No.:
HY-P1408A
Quantity:
MCE Japan Authorized Agent: