2. Peptides
  3. Peptide and Derivatives
  4. Inhibitors and Substrates
  5. M65

M65 is a deleted peptide of maxadilan (61 a.a.) with deletion of the residues between positions 24 and 42 and is a specific antagonist of PACAP type 1 receptor that inhibits ANP secretion and can be used for relevant researches.

For research use only. We do not sell to patients.

M65 Chemical Structure

M65 Chemical Structure

CAS No. : 1872440-65-7

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of M65:

Other Forms of M65:

M65 Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

M65 is a deleted peptide of maxadilan (61 a.a.) with deletion of the residues between positions 24 and 42 and is a specific antagonist of PACAP type 1 receptor that inhibits ANP secretion and can be used for relevant researches[1][2].

In Vitro

M65 (1 µM) completely blocks the cAMP accumulation stimulated by 100 nM of VIP, and partially inhibits the cAMP accumulation stimulated by 1 nM of maxadilan in rat cortical neurons[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

M65 Related Antibodies
Molecular Weight

4823.53

Formula

C205H326N64O61S5
CAS No.
Sequence

Cys-Asp-Ala-Thr-Cys-Gln-Phe-Arg-Lys-Ala-Ile-Asp-Asp-Cys-Gln-Lys-Gln-Ala-His-His-Ser-Asn-Val-Pro-Gly-Asn-Ser-Val-Phe-Lys-Glu-Cys-Met-Lys-Gln-Lys-Lys-Lys-Glu-Phe-Lys-Ala-NH2 (Disulfide bridge:Cys1-Cys5,Cys14-Cys32)
Sequence Shortening

CDATCQFRKAIDDCQKQAHHSNVPGNSVFKECMKQKKKEFKA-NH2 (Disulfide bridge:Cys1-Cys5,Cys14-Cys32)
SMILES

O=C(N[C@@H](CC(O)=O)C(N[C@@H](C)C(N[C@H]1[C@H](O)C)=O)=O)[C@H](CSSC[C@@H](C(N[C@@H](CCC(N)=O)C(N[C@@H](CC2=CC=CC=C2)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(N[C@@H](C)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC(O)=O)C(N[C@@H](CC(O)=O)C(N[C@@H](CSSC[C@@H](C(N[C@@H](CCSC)C(N[C@@H](CCCCN)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCCN)C(N[C@@H](CCCCN)C(N[C@@H](CCCCN)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC3=CC=CC=C3)C(N[C@@H](CCCCN)C(N[C@@H](C)C(N)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)NC4=O)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCCN)C(N[C@@H](CCC(N)=O)C(N[C@@H](C)C(N[C@@H](CC5=CNC=N5)C(N[C@@H](CC6=CNC=N6)C(N[C@@H](CO)C(N[C@@H](CC(N)=O)C(N[C@@H](C(C)C)C(N7[C@@H](CCC7)C(NCC(N[C@@H](CC(N)=O)C(N[C@@H](CO)C(N[C@@H](C(C)C)C(N[C@@H](CC8=CC=CC=C8)C(N[C@@H](CCCCN)C(N[C@H]4CCC(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)NC1=O)N
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

M65 Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

M651872440-65-7M 65M-65Othersmaxadilandeleted peptideVIPcAMP accumulationInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
M65
Cat. No.:
HY-P4127
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.