1. GPCR/G Protein
  2. Angiotensin Receptor
  3. Brain Natriuretic Peptide (1-32), rat

Brain Natriuretic Peptide (1-32), rat  (Synonyms: BNP (1-32), rat)

Cat. No.: HY-P1519
Handling Instructions

Brain Natriuretic Peptide (1-32), rat (BNP (1-32), rat) is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).

For research use only. We do not sell to patients.

Brain Natriuretic Peptide (1-32), rat Chemical Structure

Brain Natriuretic Peptide (1-32), rat Chemical Structure

CAS No. : 133448-20-1

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of Brain Natriuretic Peptide (1-32), rat:

Other Forms of Brain Natriuretic Peptide (1-32), rat:

Top Publications Citing Use of Products

View All Angiotensin Receptor Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Brain Natriuretic Peptide (1-32), rat (BNP (1-32), rat) is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes)[1].

In Vitro

B-type natriuretic peptide (BNP) combats cardiac stress by reducing blood pressure and ventricular fibrosis. Rat BNP BNP (1-32) (rBNP (1-32)) is an amino-truncated form of the 45 residue natural rat form of BNP[1]. Atrial natriuretic peptide-(1-28) (ANP), brain natriuretic peptide-(1-32) (BNP) and C-Type natriuretic polypeptide (CNP) occur in the brain, are concentrated in the anteroventral area of the third cerebral ventricle and participate in the regulation of body fluid homeostasis. The ANP(1-28), BNP (1-32) and CNP(1-32) function in the mammalian brain to regulate salt and water homeostasis via their receptors NPR-A and NPR-B[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

The depressor, natriuretic and cyclic GMP responses to several species of brain natriuretic peptide (BNP) are compared to atrial natriureticpeptide (ANP) 99-126 in conscious spontaneously hypertensive rats (SHR) and in conscious cynomolgus monkeys treated with vehicle or the selective neutral endopeptidase inhibitor SQ 28603. In the conscious SHR, the natriuretic and cyclic GMP responses to 3 nmol/kg i.v. rat BNP (1-32) greater than rat ANP 99-126 greater than pig BNP-26 and sre significantly potentiated by 100 mumol/kg i.v. SQ 28,603. Human BNP-32 is inactive in the SHR treated with either vehicle or SQ 28,603. In contrast, 1 nmol/kg i.v. of human BNP (1-32) stimulates renal and depressor responses in the conscious monkeys that are greater than or equal to those elicited by human ANP 99-126, whereas 3 nmol/kg i.v. rat BNP (1-32) reduces mean arterial pressure without affecting renal function[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3452.94

Formula

C146H239N47O44S3

CAS No.
Sequence

Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe (Disulfide bridge: Cys10-Cys26)

Sequence Shortening

NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: Cys10-Cys26)

SMILES

O=C([C@H](CSSC[C@H](NC(CNC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC(CNC([C@](NC([C@@H](NC([C@@H](NC([C@](NC([C@@H](NC([C@@H](NC(CNC1=O)=O)CCC(N)=O)=O)CCCCN)=O)([H])[C@@H](C)CC)=O)CC(O)=O)=O)CCCNC(N)=N)=O)([H])[C@@H](C)CC)=O)=O)C)=O)C(C)C)=O)CO)=O)CCCNC(N)=N)=O)CC(C)C)=O)=O)C(N[C@@H](CC(O)=O)C(NCC(N[C@@H](CC(C)C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC(C)C)C(N[C@H](C(O)=O)CC2=CC=CC=C2)=O)=O)=O)=O)=O)=O)NC([C@H](CO)NC([C@H](CO)NC([C@H](CO)NC([C@@H](NC([C@H](C)NC([C@H](CCSC)NC([C@H](CCCCN)NC([C@H](CO)NC([C@@H](N)CC(N)=O)=O)=O)=O)=O)=O)CC3=CN=CN3)=O)=O)=O)=O)N[C@H]1CC4=CC=CC=C4

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Brain Natriuretic Peptide (1-32), rat Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Brain Natriuretic Peptide (1-32), rat
Cat. No.:
HY-P1519
Quantity:
MCE Japan Authorized Agent: